- Recombinant Mouse Acyl-CoA wax alcohol acyltransferase 1 (Awat1)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1223570
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 37,573 Da
- E Coli or Yeast
- 1-328
- acyl-CoA wax alcohol acyltransferase 1
- Dgat2l3
- Acyl-CoA wax alcohol acyltransferase 1 (Awat1)
Sequence
MSCSMKTEHLQSLSLLQWPLSYVAMFWIVQPLLICLLFTPLWPLPTVYFVWLLLDWKTPDKGGRRSDWVRNWNVWNHIRDYFPITILKTKDLSPSENYIMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPIIRDYIMAKGLCSVSQASIDYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLLLKKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHEDSRMFKFQSLFRRIFGFYCCVFYGQGFHQDCKGLLPYHKPIITVVGEALPLPQVKNPSPEIVDKYHALYMDALYKLFEQHKVQYGCSNTQKLIFL